Invitrogen™ Human SPATA16 (aa 362-434) Control Fragment Recombinant Protein

Product Code. 30209139

Brand: Invitrogen™ RP96368

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83394 (PA5-83394. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a testis-specific protein that belongs to the tetratricopeptide repeat-like superfamily. The encoded protein localizes to the Golgi apparatus and may play a role in spermatogenesis.

Specifications

• Accession Number: Q9BXB7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83893
• Name: Human SPATA16 (aa 362-434) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4921511F01Rik; 4930503K02Rik; CDC68; FACT; FACTP140; FLJ10857; FLJ14010; NYD-SP12; RGD1563726; Spata16; spermatogenesis associated 16; spermatogenesis-associated protein 16; spermatogenesis-related protein; SPGF6; SUPT16H; testicular tissue protein Li 185; testis development protein NYD-SP12; testis-specific Golgi protein
• Common Name: SPATA16
• Gene Symbol: SPATA16
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LQALHMLPQTVDWSSFPPQQYLLTLGFKNKDDGKFLEKISSRKLPIFTEHKTPFGLTREDTVRQMETMGKRIL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining