Invitrogen™ Human Spastin (aa 234-371) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30209473	100 μL	100µL

Product Code. 30209473 Supplier Invitrogen™ Supplier No. RP89991

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53581 (PA5-53581. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the AAA (ATPases associated with a variety of cellular activities) protein family. Members of this protein family share an ATPase domain and have roles in diverse cellular processes including membrane trafficking, intracellular motility, organelle biogenesis, protein folding, and proteolysis. The encoded ATPase may be involved in the assembly or function of nuclear protein complexes. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants have been described but their full length sequences have not been determined. Mutations associated with this gene cause the most frequent form of autosomal dominant spastic paraplegia 4.

Specifications

• Accession Number: Q9UBP0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6683
• Name: Human Spastin (aa 234-371) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ADPSP; ATPase; fidgetin-like 1; FSP2; HAMAP-Rule:MF_03021}; hypothetical protein zgc:85952; Kiaa1083; KIAA183; LOW QUALITY PROTEIN: spastin; mKIAA1083; si:ch73-233a22.3; SPAST; spastic paraplegia 4 (autosomal dominant; spastic paraplegia 4 (autosomal dominant; spastin); spastic paraplegia 4 homolog; spastic paraplegia 4 protein; Spastin; spastin {ECO:0000255; SPG4; zgc:85952
• Common Name: Spastin
• Gene Symbol: SPAST
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPTTHKGTPKTNRTNKPSTPTTATRKKKDLKNFRNVDSNLANLIMNEIVDNGTAVKFDDIAGQDLAKQALQEIVILPSLRPELFTGL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining