Invitrogen™ Human SPAG4 (aa 191-279) Control Fragment Recombinant Protein

Product Code. 30200638

Brand: Invitrogen™ RP100903

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61732 (PA5-61732. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The mammalian sperm flagellum contains two cytoskeletal structures associated with the axoneme: the outer dense fibers surrounding the axoneme in the midpiece and principal piece and the fibrous sheath surrounding the outer dense fibers in the principal piece of the tail. Defects in these structures are associated with abnormal tail morphology, reduced sperm motility, and infertility. In the rat, the protein encoded by this gene associates with an outer dense fiber protein via a leucine zipper motif and localizes to the microtubules of the manchette and axoneme during sperm tail development.

Specifications

• Accession Number: Q9NPE6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6676
• Name: Human SPAG4 (aa 191-279) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700041K21Rik; acrosomal protein ACR55; cancer/testis antigen 127; CT127; mKIAA4118; MNCb-0953; outer dense fiber-associated protein SPAG4; Sad1 and UNC84 domain containing 4; SPAG4; sperm antigen 4; sperm associated antigen 4; sperm tail protein; sperm-associated antigen 4 protein; SUN domain-containing protein 4; SUN4
• Common Name: SPAG4
• Gene Symbol: SPAG4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PLENEPKEMLTLSEYHERVRSQGQQLQQLQAELDKLHKEVSTVRAANSERVAKLVFQRLNEDFVRKPDYALSSVGASIDLQKTSHDYAD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining