Invitrogen™ Human SPAG16 (aa 166-253) Control Fragment Recombinant Protein

Product Code. 30198256

Brand: Invitrogen™ RP96130

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57995 (PA5-57995. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cilia and flagella are comprised of a microtubular backbone, the axoneme, which is organized by the basal body and surrounded by plasma membrane. SPAG16 encodes 2 major proteins that associate with the axoneme of sperm tail and the nucleus of postmeiotic germ cells, respectively.

Specifications

• Accession Number: Q8N0X2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79582
• Name: Human SPAG16 (aa 166-253) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4921511D23Rik; 4930524F24Rik; 4930585K05Rik; AV261009; PF20; Pf20 protein homolog; RGD1565062; SPAG16; sperm associated antigen 16; sperm-associated antigen 16 protein; sperm-associated WD repeat protein; spg16; WD repeat domain 29; WDR29
• Common Name: SPAG16
• Gene Symbol: SPAG16
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKLINDLKGLKLHYASYEPTIRVLHEKHHTLLKEKMLTSLERDKVVG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining