Invitrogen™ Human SPACA5 (aa 36-96) Control Fragment Recombinant Protein

Product Code. 30197575

Brand: Invitrogen™ RP104371

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60813 (PA5-60813. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SPACA5 (Sperm Acrosome Associated 5) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include lysozyme activity. An important paralog of this gene is SPACA5B. [GeneCards]

Specifications

• Accession Number: Q96QH8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 389852
• Name: Human SPACA5 (aa 36-96) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Gm718; LYC5; lysozyme-like protein 5; Lyzl5; novel C-type lysozyme/alpha-lactalbumin family domain containing protein; PNPK6288; SLLP2; SLLP-X; Spaca5; SPACA5A; SPACA5B; sperm acrosome associated 5; sperm acrosome-associated protein 5; sperm lysozyme-like protein 2; sperm-specific lysozyme-like protein X; testicular tissue protein Li 113; UNQ6288; UNQ6288/PRO20753
• Common Name: SPACA5
• Gene Symbol: SPACA5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AGLNGYKGYGVGDWLCMAHYESGFDTAFVDHNPDGSSEYGIFQLNSAWWCDNGITPTKNLC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining