Invitrogen™ Human SP140 (aa 100-243) Control Fragment Recombinant Protein

Product Code. 30199479

Brand: Invitrogen™ RP89299

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (30%), Rat (30%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52263 (PA5-52263. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of the nuclear body, also known as nuclear domain 10, PML oncogenic domain, and KR body. May be involved in the pathogenesis of acute promyelocytic leukemia and viral infection.

Specifications

• Accession Number: Q13342
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11262
• Name: Human SP140 (aa 100-243) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: lymphoid-restricted homolog of Sp100; lymphoid-specific SP100 homolog; LYSP100; LYSP100-A; LYSP100-B; nuclear autoantigen Sp-140; Nuclear body protein SP140; SP140; SP140 nuclear body protein; SP140 nuclear body protein family member; speckled 140 kDa
• Common Name: SP140
• Gene Symbol: SP140
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SELEKTFGWSHLEALFSRINLMAYPDLNEIYRSFQNVCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNACHEMDDIAVPQEALSSSPRCEPGFSSESCEQLALPKAGGGDAEDAPSLLPGGGVSCKLAIQIDEGESEEMPKLLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining