Invitrogen™ Human SP110 (aa 264-356) Control Fragment Recombinant Protein

Product Code. 30195953

Brand: Invitrogen™ RP100398

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (40%), Rat (40%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Susceptibility to tuberculosis (TB) in mice has recently been attributed to the IPR1 gene. IPR1 is a member of the SP100/SP140 family of nuclear body proteins and encodes a leukocyte-specific nuclear body component. The protein can function as an activator of gene transcription and may serve as a nuclear hormone receptor coactivator. Alternative splicing has been observed for this gene and three transcript variants, encoding distinct isoforms, have been identified. SP110 is the closest homolog of the IPR1 protein in humans. The IPR1/Sp110 gene product might play a role in integrating signals generated by intracellular pathogens with mechanisms controlling innate immunity, cell death, and pathogenesis. IPR1/Sp110 is up-regulated after infection with M. tuberculosis and required by Anaplasma phagocytophilum for infection of human promyelocytic cells. Defects in Sp110 are a cause of severely impaired resistance to infection by M. tuberculosis.

Specifications

• Accession Number: Q9HB58
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3431
• Name: Human SP110 (aa 264-356) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5031415C07Rik; 52 kDa; 5830484A20Rik; ENSMUSG00000075603; IFI41; Ifi75; interferon-induced protein 41, 30 kD; interferon-induced protein 41/75; interferon-induced protein 75, 52 kD; intracellular pathogen resistance 1; intracellular pathogen resistance protein 1; Ipr1; phosphoprotein 41; phosphoprotein 75; SP110; Sp110 nuclear body protein; speckled 110 kDa; Transcriptional coactivator Sp110; VODI
• Common Name: SP110
• Gene Symbol: SP110
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EPQEVSSTPSDKKGKKRKRCIWSTPKRRHKKKSLPGGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEEIIDGTS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining