Invitrogen™ Human SOX8 (aa 173-222) Control Fragment Recombinant Protein

Product Code. 30203345

Brand: Invitrogen™ RP106880

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66194 (PA5-66194. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Sox genes comprise a family of genes that are related to the mammalian sex determining gene SRY. These genes similarly contain sequences that encode for the HMG-box domain, which is responsible for the sequence-specific DNA-binding activity. Sox genes encode putative transcriptional regulators implicated in the decision of cell fates during development and the control of diverse developmental processes. The highly complex group of Sox genes cluster at a minimum of 40 different loci that rapidly diverged in various animal lineages. At present 30 Sox genes have been identified, and members of this family have been shown to be conserved during evolution and to play key roles during animal development. Some are involved in human diseases, including sex reversal.

Specifications

• Accession Number: P57073
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 30812
• Name: Human SOX8 (aa 173-222) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: SOX8; Sox-8; SRY (sex determining region Y)-box 8; SRY box 8; SRY-box 8; SRY-box containing gene 8; transcription factor SOX-8
• Common Name: SOX8
• Gene Symbol: SOX8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PRRRKSAKAGHSDSDSGAELGPHPGGGAVYKAEAGLGDGHHHGDHTGQTH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining