missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SOX13 (aa 543-621) Control Fragment Recombinant Protein

Product Code. 30202807
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202807

Brand: Invitrogen™ RP104934

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111341 (PA5-111341. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. It has also been determined to be a type-1 diabetes autoantigen, also known as islet cell antibody 12.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UN79
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9580
Name Human SOX13 (aa 543-621) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA407916; AW259412; AW540933; ICA12; islet cell antibody 12; islet cell antigen 12; MGC117216; mSo x 13; RP11-74C13.1; SO x 13; Sox-13; SRY (Sex determining region Y)-box 13; SRY box 13; SRY-box 13; SRY-box containing gene 13; SRY-related HMG-box gene 13; transcription factor SOX-13; Type 1 diabetes autoantigen ICA12
Common Name SOX13
Gene Symbol SOX13
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DVLYPRAAGMPLAQPLVEHYVPRSLDPNMPVIVNTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGEEKSDGELVVLT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.