Invitrogen™ Human Sorbitol Dehydrogenase (aa 88-169) Control Fragment Recombinant Protein

Product Code. 30182567

Brand: Invitrogen™ RP98093

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59228 (PA5-59228. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Sorbitol dehydrogenase catalyzes the interconversion of polyols and their corresponding ketoses, and together with aldose reductase is the reduction of glucose to sorbitol by ALDR1 with NADPH as the cofactor. SORD then oxidizes the sorbitol to fructose using NADcofactor.

Specifications

• Accession Number: Q00796
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6652
• Name: Human Sorbitol Dehydrogenase (aa 88-169) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: (R,R)-butanediol dehydrogenase; epididymis secretory sperm binding protein Li 95 n; HEL-S-95 n; L-iditol 2-dehydrogenase; LOW QUALITY PROTEIN: sorbitol dehydrogenase; polyol dehydrogenase; RDH; Ribitol dehydrogenase; SDH; Sdh1; Sdh-1; Sodh-1; Sorbitol dehydrogenase; sorbitol dehydrogenase 1; SORD; SORD 1; SORD1; XDH; Xylitol dehydrogenase
• Common Name: Sorbitol Dehydrogenase
• Gene Symbol: SORD
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining