missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Sorbitol Dehydrogenase (aa 284-357) Control Fragment Recombinant Protein

Product Code. 30181570
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181570

Brand: Invitrogen™ RP98092

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59126 (PA5-59126. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Sorbitol dehydrogenase catalyzes the interconversion of polyols and their corresponding ketoses, and together with aldose reductase is the reduction of glucose to sorbitol by ALDR1 with NADPH as the cofactor. SORD then oxidizes the sorbitol to fructose using NADcofactor.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q00796
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6652
Name Human Sorbitol Dehydrogenase (aa 284-357) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias (R,R)-butanediol dehydrogenase; epididymis secretory sperm binding protein Li 95 n; HEL-S-95 n; L-iditol 2-dehydrogenase; LOW QUALITY PROTEIN: sorbitol dehydrogenase; polyol dehydrogenase; RDH; Ribitol dehydrogenase; SDH; Sdh1; Sdh-1; Sodh-1; Sorbitol dehydrogenase; sorbitol dehydrogenase 1; SORD; SORD 1; SORD1; XDH; Xylitol dehydrogenase
Common Name Sorbitol Dehydrogenase
Gene Symbol SORD
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.