Invitrogen™ Human SOD2 (aa 6-150) Control Fragment Recombinant Protein

Product Code. 30180925

Brand: Invitrogen™ RP99373

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Superoxide dismutase (SOD) is an antioxidant enzyme involved in the defense system against reactive oxygen species (ROS). SOD catalyzes the dismutation reaction of superoxide radical anion (O2) to hydrogen peroxide, which is then catalyzed to innocuous O2 and H2O by glutathione peroxidase and catalase. Several classes of SOD have been identified. These include intracellular copper, zinc SOD (Cu, Zn-SOD/SOD-1), mitochondrial manganese SOD (Mn-SOD/SOD-2) and extracellular Cu, Zn-SOD (EC-SOD/SOD-3). SOD1 is found in all eukaryotic species as a homodimeric 32 kDa enzyme containing one each of Cu and Zn ion per subunit. The manganese containing 80 kDa tetrameric enzyme SOD2, is located in the mitochondrial matrix in close proximity to a primary endogenous source of superoxide, the mitochondrial respiratory chain. SOD3 is a heparin-binding multimer of disulfide-linked dimers, primarily expressed in human lungs, vessel walls and airways. SOD4 is a copper chaperone for superoxide dismutase (CCS), which specifically delivers Cu to copper/zinc superoxide dismutase. CCS may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor.

Specifications

• Accession Number: P04179
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6648
• Name: Human SOD2 (aa 6-150) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: I79_015272; indophenoloxidase B; IPO B; IPOB; IPO-B; manganese SOD; manganese superoxide dismutase; manganese-containing superoxide dismutase; mangano-superoxide dismutase; manganous superoxide dismutase; mitochondrial superoxide dismutase 2; Mn superoxide dismutase; MNSOD; Mn-SOD; MVCD6; similar to manganous superoxide dismutase; Sod2; Sod-2; sod2.L; sodMt; Superoxide dimutase 2, mitochondrial; superoxide dismutase; superoxide dismutase (Mn type); superoxide dismutase [Mn], mitochondrial; superoxide dismutase 2; superoxide dismutase 2 L homeolog; superoxide dismutase 2, mitochondrial; superoxide dismutase 2, mitochondrial L homeolog
• Common Name: SOD2 (MnSOD)
• Gene Symbol: SOD2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining