Invitrogen™ Human SOCS3 (aa 136-225) Control Fragment Recombinant Protein

Product Code. 30201299

Brand: Invitrogen™ RP105454

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111637 (PA5-111637. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Accumulating evidence demonstrates that cytokine receptor signaling is negatively regulated by a family of Src homology 2 domain-containing adaptor molecules Termed SOCS (Suppressor of Cytokine Signaling). To date, there are eight members of SOCS family have been recognized, they are SOCS-1, 2, 3, 4, 5, 6, 7 and CIS. Structurally the SOCS proteins are composed of an N-terminal region of variable length and amino acid composition, a central SH2 domain, and a previously unrecognized C-terminal motif that we have called the SOCS box. The SOCS proteins appear to form part of a classical negative feed back loop that regulates cytokine signal transduction via a STAT-induced transcriptional mechanism. Transcription of each of the SOCS genes occurs rapidly in vitro and in vivo in response to cytokines, and once produced, the various members of the SOCS family appear to inhibit signaling in different ways.

Specifications

• Accession Number: O14543
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9021
• Name: Human SOCS3 (aa 136-225) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ATOD4; CIS3; CIS-3; Cish3; cytokine inducible SH2-containing protein 3; cytokine-inducible SH2 protein 3; E2a-Pbx1 target gene in fibroblasts 10; Ef10; EF-10; MGC71791; Protein EF-10; Socs3; Socs-3; SSI3; SSI-3; STAT-induced STAT inhibitor 3; Suppressor of cytokine signaling 3
• Common Name: SOCS3
• Gene Symbol: Socs3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining