Invitrogen™ Human SOCS1 (aa 174-211) Control Fragment Recombinant Protein

Product Code. 30204641

Brand: Invitrogen™ RP107973

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Suppressor of cytokine signaling (SOCS) and cytokine-inducible SH2 proteins are a family of intracellular proteins which regulate the immune cell responses to cytokines. SOCS1 acts to suppress dendritic cell (DC) as well as T cell hyperactivation following cytokine signaling by inhibiting JAK tyrosine kinase, a kinase necessary for type I and II cytokine receptors to initiate signaling, by directly binding to the catalytic domain of the kinase. SOCS1 also possesses E3 ubiquitin protein ligase activity that results in the polyubiquitination of its target proteins and subsequent degradation by the proteosome. It is through this method that SOCS1 negatively regulates signaling by Toll-like receptors TLR2 and TLR4 by mediating the degradation of the TLR signaling adaptor protein TIRAP.

Specifications

• Accession Number: O15524
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8651
• Name: Human SOCS1 (aa 174-211) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CIS1; Cish1; Cish7; cytokine inducible SH2-containing protein 1; cytokine inducible SH2-containing protein 7; cytokine-inducible SH2 protein 1; JAB; JAK binding protein; JAK2-binding protein; JAK-binding protein; Socs1; SOCS-1; SSI1; SSI-1; STAT induced SH3 protein 1; STAT-induced STAT inhibitor 1; Suppressor of cytokine signaling 1; Tec-interacting protein 3; TIP3; TIP-3
• Common Name: SOCS1
• Gene Symbol: Socs1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining