Invitrogen™ Human SNX6 Control Fragment Recombinant Protein

Product Code. 30209784

Brand: Invitrogen™ RP100955

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61948 (PA5-61948. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SNX6 interacts with members of the transforming growth factor-beta family of receptor serine-threonine kinases. These receptors belong to two classes: type II receptors that bind ligand, and type I receptors that are subsequently recruited to transduce the signal. Of the type II receptors, SNX6 was found to interact strongly with ActRIIB and more moderately with wild type and kinase-defective mutants of TbetaRII. Of the type I receptors, SNX6 was found to interact only with inactivated TbetaRI. SNXs 1-4 also interacted with the transforming growth factor-beta receptor family, showing different receptor preferences. Conversely, SNX6 behaved similarly to the other SNX proteins in its interactions with receptor tyrosine kinases. Strong heteromeric interactions were also seen among SNX1, -2, -4, and -6, suggesting the formation in vivo of oligomeric complexes. These findings are the first evidence for the association of the SNX family of molecules with receptor serine-threonine kinases.

Specifications

• Accession Number: Q9UNH7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 58533
• Name: Human SNX6 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010006G21Rik; 2610032J07Rik; 2810425K19Rik; AU018928; C85963; MSTP010; SNX6; sorting nexin 6; sorting nexin-6; Sorting nexin-6, N-terminally processed; TFAF2; TRAF4-associated factor 2; tumor necrosis factor receptor-associated factor 4(TRAF4)-associated factor 2
• Common Name: SNX6
• Gene Symbol: SNX6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLGAAMMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining