missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SNX33 (aa 190-242) Control Fragment Recombinant Protein

Product Code. 30182005
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30182005

Brand: Invitrogen™ RP98138

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59378 (PA5-59378. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SNX33 (sorting nexin-33), also known as SH3PX3, SH3PXD3C or SNX30, is a 574 amino acid protein that interacts with ADAM15 and FAS-L. Belonging to the sorting nexin family, SNX33 contains one BAR domain, one PX (phox homology) domain and one SH3 domain. The gene that encodes SNX33 consists of over 14,000 bases and maps to human chromosome 15q24.2. Housing approximately 106 million base pairs and encoding more than 700 genes, chromosome 15 makes up about 3% of the human genome. Angelman and Prader-Willi syndromes are associated with loss of function or deletion of genes in the 15q11-q13 region.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8WV41
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 257364
Name Human SNX33 (aa 190-242) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias SH3 and PX domain containing 3; SH3 and PX domain-containing protein 3; SH3PX3; SH3PXD3C; SNX30; SNX33; sorting nexin 33; sorting nexin-33
Common Name SNX33
Gene Symbol SNX33
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VRSGVEAFILGDVPMMAKIAETYSIEMGPRGPQWKANPHPFACSVEDPTKQTK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.