Invitrogen™ Human SNX26 (aa 239-308) Control Fragment Recombinant Protein

Product Code. 30205985

Brand: Invitrogen™ RP95544

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56351 (PA5-56351. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the sorting nexin family. Members of this family contain a phox domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. Alternative splice variants encoding different isoforms have been identified in this gene.

Specifications

• Accession Number: O14559
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 115703
• Name: Human SNX26 (aa 239-308) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ARHGAP33; AW324378; FLJ39019; neurite outgrowth multiadaptor RhoGAP protein; NOMA-GAP; Rho GTPase activating protein 33; rho GTPase-activating protein 33; rho GTPase-activating protein 33; LOW QUALITY PROTEIN: rho GTPase-activating protein 33; rho-type GTPase-activating protein 33; Snx26; sorting nexin 26; sorting nexin-26; Tc10/CDC42 GTPase-activating protein; TCGAP
• Common Name: SNX26
• Gene Symbol: ARHGAP33
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PSECVELFTERPGPGLKADADGPPCGIPAPQGISSLTSAVPRPRGKLAGLLRTFMRSRPSRQRLRQRGIL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining