Invitrogen™ Human SNX18 (aa 155-230) Control Fragment Recombinant Protein

Product Code. 30197735

Brand: Invitrogen™ RP96965

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58113 (PA5-58113. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members, but contains a SH3 domain. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifikationer

• Accession Number: Q96RF0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 112574
• Name: Human SNX18 (aa 155-230) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: SH3 and PX domain-containing protein 3 B; SH3P x 2; SH3PXD3B; Snag1; Sn x 18; sorting nexin 18; sorting nexin associated golgi protein 1; sorting nexin-18; Sorting nexin-associated Golgi protein 1
• Common Name: SNX18
• Gene Symbol: SNX18
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DDEWDDSSTVADEPGALGSGAYPDLDGSSSAGVGAAGRYRLSTRSDLSLGSRGGSVPPQHHPSGPKSSATVSRNLN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining