Invitrogen™ Human SNW1 (aa 367-504) Control Fragment Recombinant Protein

Produktkode 30199240

missing translation for 'mfr': Invitrogen™ RP88945

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82017 (PA5-82017. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CSTF2 is one of three (including CSTF1 and CSTF3) cleavage stimulation factors which combine to form CSTF which is involved in the polyadenylation and 3'end cleavage of pre-mRNAs. CSTF2 contains a ribonucleoprotein-type RNA binding domain. CSTF2 is upregulated during activation of B cells which results in the switch of IgM heavy chain mRNA from membrane bound form to the secreted form.

Tekniske data

• Accession Number: Q13573
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22938
• Name: Human SNW1 (aa 367-504) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310008B08Rik; AW048543; Bx42; homolog of Drosophila BX42; NCOA-62; Nuclear protein SkiP; nuclear receptor coactivator NCoA-62; nuclear receptor coactivator, 62-kD; PPS; Prp45; PRPF45; RGD1561926; SKI interacting protein; ski-interacting protein; Skiip; SKIP; SNW domain containing 1; SNW domain-containing protein 1; SNW1
• Common Name: SNW1
• Gene Symbol: Snw1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining