Invitrogen™ Human SNTB1 (aa 430-493) Control Fragment Recombinant Protein

Product Code. 30212004

Brand: Invitrogen™ RP93902

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55143 (PA5-55143. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Adapter protein that binds to and probably organizes the subcellular localization of a variety of membrane proteins. May link various receptors to the actin cytoskeleton and the dystrophin glycoprotein complex.

Specifications

• Accession Number: Q13884
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6641
• Name: Human SNTB1 (aa 430-493) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 59 kDa dystrophin-associated protein A1 basic component 1; 59-1 DAP; 59-DAP; A1B; beta-1-syntrophin; beta1-Syntrophin; BSYN2; DAPA1B; dystrophin-associated protein A1, 59 kD, basic component 1; SNT2; SNT2B1; SNTB1; syntrophin beta 1; syntrophin, basic 1; syntrophin, beta 1; syntrophin, beta 1 (dystrophin-associated protein A1, 59 kDa, basic component 1); syntrophin-2; Tax interaction protein 43; TIP-43
• Common Name: SNTB1
• Gene Symbol: SNTB1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QGCHNSAELIAEISTACTYKNQECRLTIHYENGFSITTEPQEGAFPKTIIQSPYEKLKMSSDDG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining