missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SNRPD1 (aa 35-100) Control Fragment Recombinant Protein

Product Code. 30180705
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30180705

Brand: Invitrogen™ RP98266

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59206 (PA5-59206. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SNRPD1 is a small nuclear ribonucleoprotein that belongs to the SNRNP core protein family. This protein may act as a charged protein scaffold to promote SNRNP assembly or strengthen SNRNP-SNRNP interactions through nonspecific electrostatic contacts with RNA.
TRUSTED_SUSTAINABILITY

Spezifikation

Accession Number P62314
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6632
Name Human SNRPD1 (aa 35-100) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA407109; AL023031; CHUNP6882; fk26a01; HsT2456; small nuclear ribonucleoprotein D1; small nuclear ribonucleoprotein D1 polypeptide; small nuclear ribonucleoprotein D1 polypeptide 16 kDa; small nuclear ribonucleoprotein D1 polypeptide 16 kDa pseudogene; small nuclear ribonucleoprotein D2 polypeptide 16.5 kDa; small nuclear ribonucleoprotein Sm D1; Sm-D autoantigen; SMD1; sm-D1; snprd1; snRNP core protein D1; snrnpd1; SNRPD; Snrpd1; snrpd1 protein; wu:fk26a01; zgc:86929
Common Name SNRPD1
Gene Symbol SNRPD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt