Invitrogen™ Human SNRPC (aa 34-80) Control Fragment Recombinant Protein

Product Code. 30196293

Brand: Invitrogen™ RP103217

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63136 (PA5-63136. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SNRPC is associated with snRNP U1.

Specifications

• Accession Number: P09234
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6631
• Name: Human SNRPC (aa 34-80) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: small nuclear ribonucleoprotein polypeptide C; Snrp1c; Snrpc; U1 small nuclear ribonucleoprotein 1 C; U1 small nuclear ribonucleoprotein C; U1 small nuclear RNP specific C; U1 snRNP C; U1 snRNP protein C; U1C; U1-C; U1C protein; Yhc1
• Common Name: SNRPC
• Gene Symbol: SNRPC
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining