Invitrogen™ Human SNRPA1 (aa 125-198) Control Fragment Recombinant Protein

Product Code. 30181493

Brand: Invitrogen™ RP99044

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61053 (PA5-61053. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SNRPA1 (U2 snRNP-A) is located in gene map locus 15q26. 3 and is a 28 kDa protein, isa specific component of U2 snRNP particle and consists of a unique N-terminal leucine-rich region and an extremely hydrophobic RNA-binding C-terminal region. It lacks segments homologous to RNP1 and RNP2, commonA. A motifs found in several RNA-binding proteins. It associates with U2 snRNP and participates in transcription and pre-mRNA splicing. It might play an important role in cell division and proliferation. Patients with connective tissue disorders often produce autoantibodies against snRNP particles.

Specifications

• Accession Number: P09661
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6627
• Name: Human SNRPA1 (aa 125-198) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500015N06Rik; Lea1; small nuclear ribonucleoprotein polypeptide A'; Snrpa1; U2 small nuclear ribonucleoprotein A'; U2 small nuclear ribonucleoprotein polypeptide A'; U2 snRNP A'; U2 snRNP-A'
• Common Name: SNRPA1
• Gene Symbol: SNRPA1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining