missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SNRPA1 (aa 125-198) Control Fragment Recombinant Protein

Product Code. 30181493
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181493

Brand: Invitrogen™ RP99044

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61053 (PA5-61053. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SNRPA1 (U2 snRNP-A) is located in gene map locus 15q26. 3 and is a 28 kDa protein, isa specific component of U2 snRNP particle and consists of a unique N-terminal leucine-rich region and an extremely hydrophobic RNA-binding C-terminal region. It lacks segments homologous to RNP1 and RNP2, commonA. A motifs found in several RNA-binding proteins. It associates with U2 snRNP and participates in transcription and pre-mRNA splicing. It might play an important role in cell division and proliferation. Patients with connective tissue disorders often produce autoantibodies against snRNP particles.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P09661
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6627
Name Human SNRPA1 (aa 125-198) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1500015N06Rik; Lea1; small nuclear ribonucleoprotein polypeptide A'; Snrpa1; U2 small nuclear ribonucleoprotein A'; U2 small nuclear ribonucleoprotein polypeptide A'; U2 snRNP A'; U2 snRNP-A'
Common Name SNRPA1
Gene Symbol SNRPA1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.