missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207093

Invitrogen™ Human SNRNP40 (aa 97-188) Control Fragment Recombinant Protein

Product Code. 30207093
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207093

Brand: Invitrogen™ RP94000

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55589 (PA5-55589. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a component of the U5 small nuclear ribonucleoprotein (snRNP) particle. The U5 snRNP is part of the spliceosome, a multiprotein complex that catalyzes the removal of introns from pre-messenger RNAs.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96DI7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9410
Name Human SNRNP40 (aa 97-188) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610009C03Rik; 38 kDa-splicing factor; 40 K; HPRP8BP; Prp8-binding protein; Prp8bp; PRPF8BP; RGD1309198; RP11-490K7.3; SFP38; small nuclear ribonucleoprotein 40 (U5); small nuclear ribonucleoprotein 40 kDa (U5); small nuclear ribonucleoprotein U5 subunit 40; small nuclear ribonucleoprotein, U5 40 kDa subunit; Snrnp40; SPF38; U5 small nuclear ribonucleoprotein 40 kDa protein; U5 snRNP 40 kDa protein; U5 snRNP-specific 40 kDa protein; U5 snRNP-specific 40 kDa protein (hPrp8-binding); U5 snRNP-specific protein (Prp8-binding); U5-40 K; U5-40 kD protein; WD repeat domain 57 (U5 snRNP specific); WD repeat-containing protein 57; Wdr57
Common Name SNRNP40
Gene Symbol SNRNP40
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.