Invitrogen™ Human SnoN (aa 310-448) Control Fragment Recombinant Protein

Product Code. 30207600

Brand: Invitrogen™ RP89553

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TGF-beta is a ubiquitously expressed cytokine that signals through the Smad protein family to regulate numerous cellular processes such as embryonic development and tumorigenesis. This signaling is negatively regulated by Ski, the mammalian homolog of the transforming protein of an avian retrovirus that induces oncogenic transformation of chicken embryo cells, and the related protein SnoN. Like Ski, SnoN functions by binding to the Smad proteins and preventing their phosphorylation, thereby inhibiting their ability to bind DNA and activate the transcription of downstream genes. SnoN is located primarily in the nucleus in cancer tissues or cells, but in the cytoplasm in normal tissues or primary epithelial cells.

Spécification

• Accession Number: P12757
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6498
• Name: Human SnoN (aa 310-448) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: EGK_11909; LOW QUALITY PROTEIN: ski-like protein; SKI like proto-oncogene; ski/sno related; SKIL; SKI-like; SKI-like oncogene; ski-like protein; ski-like protein-like; SKI-like proto-oncogene; Skir; ski-related oncogene; ski-related oncogene snoN; Ski-related protein; SNO; SnoA; SnoI; SnoN; v-ski sarcoma viral oncogene homolog
• Common Name: SnoN
• Gene Symbol: SKIL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSKTDAPSGMELQSWYPVIKQEGDHVSQTHSFLHPSYYLYMCDKVVAPNVSLTSAVSQSKELTKTEASKSISRQSEKAHSSGKLQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining