missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SNAPC4 (aa 1292-1412) Control Fragment Recombinant Protein

Product Code. 30199169
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30199169 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30199169 Supplier Invitrogen™ Supplier No. RP89387

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-144744 (PA5-144744, PA5-61263 (PA5-61263. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5SXM2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6621
Name Human SNAPC4 (aa 1292-1412) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias GTAR; KIAA0697; proximal sequence element-binding transcription factor subunit alpha; PSE-binding factor subunit alpha; PTF subunit alpha; PTFalpha; small nuclear RNA activating complex polypeptide 4; small nuclear RNA activating complex, polypeptide 4; small nuclear RNA activating complex, polypeptide 4, 190 kD; small nuclear RNA activating complex, polypeptide 4, 190 kDa; SNAP190; SNAPc 190 kDa subunit; SNAPc subunit 4; SNAPC4; snRNA-activating protein complex 190 kDa subunit; snRNA-activating protein complex subunit 4
Common Name SNAPC4
Gene Symbol SNAPC4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VRVPLLGSRLPYQPPALCSLRALSGLLLHKKALEHKATSLVVGGEAERPAGALQASLGLVRGQLQDNPAYLLLRARFLAAFTLPALLATLAPQGVRTTLSVPSRVGSESEDEDLLSELELA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.