Invitrogen™ Human SNAP29 (aa 186-248) Control Fragment Recombinant Protein

Product Code. 30201681

Brand: Invitrogen™ RP95340

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56870 (PA5-56870. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SNAP29 encodes a product that is a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene.

Specifications

• Accession Number: O95721
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9342
• Name: Human SNAP29 (aa 186-248) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1300018G05Rik; AI891940; AU020222; BB131856; CEDNIK; fc84f09; FLJ21051; golgi SNARE of 32 kDa; Gs32; im:7145101; LOC553460 protein; si:dkey-178e17.4; SNAP29; SNAP-29; Soluble 29 kDa NSF attachment protein; synaptosomal-associated protein 29; synaptosomal-associated protein 29 kD; synaptosomal-associated protein, 29 kD; synaptosomal-associated protein, 29 kDa; synaptosome associated protein 29; synaptosome associated protein 29 kDa; vesicle-membrane fusion protein SNAP-29; wu:fc84f09
• Common Name: SNAP29
• Gene Symbol: Snap29
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining