Invitrogen™ Human SNAP alpha (aa 38-80) Control Fragment Recombinant Protein

Product Code. 30182419

Brand: Invitrogen™ RP98823

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83808 (PA5-83808. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SNAPs (soluble NSF attachment proteins), acting in concert with SNAREs (SNAP receptors) and the N-ethylmaleimide-sensitive fusion protein (NSF) are required for the fusion of transport vesicles to their target membranes in synaptic transmission, intra-Golgi transport, endosome-to-endosome fusion and transcytotic vesicles-to-plasma membrane transport. Vesicle-to-target membrane docking (initial contact) occurs when the vesicle SNARE binds to its cognate target membrane SNARE. a-SNAP (or b-SNAP in brain) then binds to this docking complex and mediates the binding of NSF and thus the formation of a 20S fusion particle. It is thought that, once NSF is bound, ATP hydrolysis by NSF initiates the fusion process.

Specifications

• Accession Number: P54920
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8775
• Name: Human SNAP alpha (aa 38-80) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500039N14Rik; alpha snap; alpha soluble NSF attachment protein; alpha-SNAP; Alpha-soluble NSF attachment protein; a-SNAP; AW209189; hydrocephaly with hop gait; hyh; Napa; N-ethylmaleimide sensitive fusion protein attachment protein alpha; N-ethylmaleimide-sensitive factor attachment protein alpha; N-ethylmaleimide-sensitive factor attachment protein, alpha; NSF attachment protein alpha; RA81; Snap; SNAPA; SNAP-alpha; SNARE
• Common Name: SNAP alpha
• Gene Symbol: NAPA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IEEACEIYARAANMFKMAKNWSAAGNAFCQAAQLHLQLQSKHD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining