missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30212174

Invitrogen™ Human SNAIL (aa 117-167) Control Fragment Recombinant Protein

Product Code. 30212174
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212174

Brand: Invitrogen™ RP108418

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Zinc finger protein SNAI1 (SNAIL)is a zinc finger transcriptional repressor which down regulates the expression of the ectodermal gene within the mesoderm and functions to form the mesoderm and neural crest. It is reported that SNAI1 acts as an important factor of tumor invasion as evidenced by its role in E-cadherin down-regulation and induction of epithelial-mesenchymal transition (EMT). In human breast cancer, the expression of SNAI1 and/or the homologous SNAI2 (Slug) has been associated with E-cadherin repression, local or distant metastasis, tumor recurrence, or poor prognosis in different tumor series. It is also reported that Snail 1 protein in the stromamay be anew putative prognosis marker for colon tumors.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O95863
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6615
Name Human SNAIL (aa 117-167) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI194338; dJ710H13.1; Protein sna; protein snail homolog 1; SLUGH2; SNA; Sna protein; Sna1; SNAH; snai; SNAI1; Snail; snail 1; snail 1 homolog; snail 1 zinc finger protein; snail 1, zinc finger protein; snail family transcriptional repressor 1; snail family zinc finger 1; snail homolog 1; Snail1; Zinc finger protein SNAI1
Common Name SNAIL
Gene Symbol Snai1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.