Invitrogen™ Human SMYD5 (aa 117-215) Control Fragment Recombinant Protein

Product Code. 30196365

Brand: Invitrogen™ RP103042

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61859 (PA5-61859. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Retinoic acid (RA) represents the oxidized form of vitamin A and, via interactions with retinoic acid receptors (RARs), plays a crucial role in development, cellular growth and differentiation. The gene encoding RAI15 maps to human chromosome 2, which houses over 1,400 genes and comprises nearly 8% of the human genome. Harlequin icthyosis, a rare and morbid skin deformity, is associated with mutations in the ABCA12 gene, while the lipid metabolic disorder sitosterolemia is associated with defects in the ABCG5 and ABCG8 genes. Additionally, an extremely rare recessive genetic disorder, Alström syndrome, is caused by mutations in the ALMS1 gene, which maps to chromosome 2.

Specifications

• Accession Number: Q6GMV2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10322
• Name: Human SMYD5 (aa 117-215) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW536703; NN8-4 AG; Protein NN8 4 AG; Protein NN8-4 AG; Rai15; retinoic acid induced 15; retinoic acid responsive; retinoic acid responsive gene 1; retinoic acid-induced protein 15; RRG1; SET and MYND domain containing 5; SET and MYND domain-containing protein 5; SMYD family member 5; SMYD5; ZMYND23
• Common Name: SMYD5
• Gene Symbol: SMYD5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MYCSAECRLAATEQYHQVLCPGPSQDDPLHPLNKLQEAWRSIHYPPETASIMLMARMVATVKQAKDKDRWIRLFSQFCNKTANEEEEIVHKLLGDKFKG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining