missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SMURF1 (aa 153-230) Control Fragment Recombinant Protein

Product Code. 30205783
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205783

missing translation for 'mfr': Invitrogen™ RP108738

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Members of the transforming growth factor-beta (TGFB) family signal through type I and type II serine/threonine-kinase receptors, which in turn activate the SMAD signaling pathway. Bone morphogenetic protein (BMP) receptors target SMAD1, SMAD5, and SMAD8, whereas receptors for activin and TGFB (e. g., ACVR1 and TGFBR1, respectively) target SMAD2 and SMAD3. Phosphorylation of these receptor-regulated SMADs induces their association with the common-partner SMAD, SMAD4. Smurf1, a HECT domain E3 ubiquitin ligase, regulates cell polarity and protrusive activity and is required to maintain the transformed morphology and motility of a tumor cell. Atypical protein kinase C-zeta (PKC2), an effector of the Cdc42/Rac1-PAR6 polarity complex, recruits Smurf1 to cellular protrusions, where it controlled the local level of RhoA. Smurf1 thus links the polarity complex to degradation of RhoA in lamellipodia and filopodia to prevent RhoA signaling during dynamic membrane movements.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9HCE7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57154
Name Human SMURF1 (aa 153-230) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930431E10Rik; E3 ubiquitin ligase SMURF1; E3 ubiquitin ligase SMURF2; E3 ubiquitin-protein ligase SMURF1; E3 ubiquitin-protein ligase SMURF2; HECT-type E3 ubiquitin transferase SMURF1; HECT-type E3 ubiquitin transferase SMURF2; hSMURF1; hSMURF2; KIAA1625; mKIAA1625; RGD1309707; SMAD specific E3 ubiquitin protein ligase 1; SMAD specific E3 ubiquitin protein ligase 2; Smad ubiquitination regulatory factor 1; SMAD ubiquitination regulatory factor 2; Smad-specific E3 ubiquitin ligase 1; SMAD-specific E3 ubiquitin-protein ligase 1; SMAD-specific E3 ubiquitin-protein ligase 2; SMURF1; SMURF2
Common Name SMURF1
Gene Symbol Smurf1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.