Invitrogen™ Human SMUG1 (aa 151-265) Control Fragment Recombinant Protein

Product Code. 30212899

Brand: Invitrogen™ RP108763

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SMUG1 is a glycosylase that removes uracil from single- and double-stranded DNA in nuclear chromatin, thus contributing to base excision repair.

Specifications

• Accession Number: Q53HV7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23583
• Name: Human SMUG1 (aa 151-265) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200013B09Rik; A930006H09Rik; C85220; FDG; HMUDG; MGC104370; single-strand selective monofunctional uracil DNA glycosylase; Single-strand selective monofunctional uracil-DNA glycosylase; single-strand-selective monofunctional uracil-DNA glycosylase 1; SMUG1; UNG3
• Common Name: SMUG1
• Gene Symbol: SMUG1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QPEVFFHHCFVHNLCPLLFLAPSGRNLTPAELPAKQREQLLGICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLMPEVQVEGLLHPSPRNPQANKGWEAVAKERLNELGLL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining