missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SMO Partial ORF (NP_005622.1, 461 a.a. - 519 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006608-Q03.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16074735

  • £425.00 / 25µg
Estimated Shipment: 17-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: GFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKQPIPDCEIKNRPSLLVEK
Specifications

Specifications

NP_005622.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.12kDa
12.5% SDS-PAGE Stained with Coomassie Blue
GFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKQPIPDCEIKNRPSLLVEK
RUO
SMO
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
6608
SMO (Human) Recombinant Protein (Q03)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gx/SMOH
SMO
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers