missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205698

Invitrogen™ Human SMG1 (aa 1825-1917) Control Fragment Recombinant Protein

Produktkod. 30205698
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
Förpackningsstorlek
100µL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30205698

missing translation for 'mfr': Invitrogen™ RP107960

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67318 (PA5-67318. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein involved in nonsense-mediated mRNA decay as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein. Alternative spliced transcript variants have been described, but their full-length natures have not been determined.
TRUSTED_SUSTAINABILITY

Specifikationer

Accession Number Q96Q15
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23049
Name Human SMG1 (aa 1825-1917) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610207I05Rik; 5430435M13Rik; 61E3.4; ATX; C130002K18Rik; hSMG-1; KIAA0421; lambda/iota protein kinase C-interacting protein; Lambda-interacting protein; LIP; mKIAA0421; phosphatidylinositol 3-kinase-related protein kinase; PI-3-kinase-related kinase SMG-1; RGD1563508; serine/threonine-protein kinase SMG1; SMG1; SMG-1; smg-1 homolog, phosphatidylinositol 3-kinase-related kinase; SMG1 homolog, phosphatidylinositol 3-kinase-related kinase (C. elegans); SMG1 phosphatidylinositol 3-kinase-related kinase; SMG1, nonsense mediated mRNA decay associated PI3K related kinase
Common Name SMG1
Gene Symbol SMG1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QLFSRLNHPEVYVRQSICNLLCRVAQDSPHLILYPAIVGTISLSSESQASGNKFSTAIPTLLGNIQGEELLVSECEGGSPPASQDSNKDEPKS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.