missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210299

Invitrogen™ Human SMEK1 (aa 641-691) Control Fragment Recombinant Protein

Product Code. 30210299
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210299

Brand: Invitrogen™ RP105293

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66644 (PA5-66644. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulatory subunit of serine/threonine-protein phosphatase 4. May regulate the activity of PPP4C at centrosomal microtubule organizing centers. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AFX phosphorylated on 'Ser-140' (gamma-H2AFX) generated during DNA replication and required for DNA DSB repair.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6IN85
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55671
Name Human SMEK1 (aa 641-691) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110034C04Rik; BC064465; FLFL1; KIAA2010; mKIAA2010; MSTP033; PP4R3; PP4R3A; Ppp4r3a; protein phosphatase 4 regulatory subunit 3 A; protein phosphatase 4, regulatory subunit 3 A; RGD1309059; serine/threonine-protein phosphatase 4 regulatory subunit 3 A; SMEK homolog 1; SMEK homolog 1, suppressor of mek1; SMEK homolog 1, suppressor of mek1 (Dictyostelium); SMEK1; smk1; smk-1
Common Name SMEK1
Gene Symbol PPP4R3A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KLRFEQQRERQDNPKLDSMRSILRNHRYRRDARTLEDEEEMWFNTDEDDME
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.