Invitrogen™ Human SMCR8 (aa 279-396) Control Fragment Recombinant Protein

Product Code. 30199041

Brand: Invitrogen™ RP93456

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54449 (PA5-54449. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of the C9orf72-SMCR8 complex, a complex that has guanine nucleotide exchange factor (GEF) activity and regulates autophagy. In the complex, C9orf72 and SMCR8 probably constitute the catalytic subunits that promote the exchange of GDP to GTP, converting inactive GDP-bound RAB8A and RAB39B into their active GTP-bound form, thereby promoting autophagosome maturation. The C9orf72-SMCR8 complex also acts as a negative regulator of autophagy initiation by interacting with the ATG1/ULK1 kinase complex and inhibiting its protein kinase activity. Acts as a regulator of mTORC1 signaling by promoting phosphorylation of mTORC1 substrates. In addition to its activity in the cytoplasm within the C9orf72-SMCR8 complex, SMCR8 also localizes in the nucleus, where it associates with chromatin and negatively regulates expression of suppresses ULK1 and WIPI2 genes.

Specifications

• Accession Number: Q8TEV9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 140775
• Name: Human SMCR8 (aa 279-396) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310076G09Rik; AI642055; D030073L15Rik; FLJ34716; Guanine nucleotide exchange protein SMCR8; RGD1564621; SMCR8; Smith-Magenis syndrome chromosomal region candidate gene 8 protein; Smith-Magenis syndrome chromosomal region candidate gene 8 protein homolog; Smith-Magenis syndrome chromosome region, candidate 8; Smith-Magenis syndrome chromosome region, candidate 8 homolog; Smith-Magenis syndrome chromosome region, candidate 8 homolog (human)
• Common Name: SMCR8
• Gene Symbol: SMCR8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SQASTTSNPDESADTDLYTCRPAYTPKLIKAKSTKCFDKKLKTLEELCDTEYFTQTLAQLSHIEHMFRGDLCYLLTSQIDRALLKQQHITNFLFEDFVEVDDRMVEKQESIPSKPSQD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining