Invitrogen™ Human SMCR7 (aa 85-197) Control Fragment Recombinant Protein

Product Code. 30198825

Brand: Invitrogen™ RP90491

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59950 (PA5-59950. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an outer mitochondrial membrane protein that functions in the regulation of mitochondrial morphology. It can directly recruit the fission mediator dynamin-related protein 1 (Drp1) to the mitochondrial surface. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing results in multiple transcript variants encoding different isoforms.

Specifications

• Accession Number: Q96C03
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 125170
• Name: Human SMCR7 (aa 85-197) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI482195; Gm11; Mid49; MIEF2; mitochondrial dynamic protein MID49; mitochondrial dynamic protein of 49 kDa; mitochondrial dynamic protein of 49 kDa homolog; mitochondrial dynamics protein MID49; Mitochondrial dynamics protein of 49 kDa; mitochondrial dynamics protein of 49 kDa homolog; Mitochondrial elongation factor 2; RGD1560728; SMCR7; Smith-Magenis syndrome chromosomal region candidate gene 7 protein; smith-Magenis syndrome chromosomal region candidate gene 7 protein homolog; Smith-Magenis syndrome chromosome region, candidate 7; Smith-Magenis syndrome chromosome region, candidate 7 homolog
• Common Name: SMCR7
• Gene Symbol: MIEF2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PPAALSQPVLPLAPSSSAPEGPAETDPEVTPQLSSPAPLCLTLQERLLAFERDRVTIPAAQVALAKQLAGDIALELQAYFRSKFPELPFGAFVPGGPLYDGLQAGAADHVRLL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining