Invitrogen™ Human SMC2 (aa 485-601) Control Fragment Recombinant Protein

Product Code. 30211793

Brand: Invitrogen™ RP104066

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64459 (PA5-64459. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CAP-E and CAP-C (Chromosome Associated Protein-E & C) are also SMC (Structural Maintenance of Chromosome) family members that form a heterodimeric complex required for mitotic chromosome condensation to achieve proper segregation of genetic information during subsequent cell division. hCAP-C/hCAP-E is a component of a multiprotein complex called condensin that interacts with phosphorylation of Histone H3 resulting in the mitotic chromosome condensation. The distribution patterns of the two heterodimeric complexes in interphase nucleus indicate independent behavior of the two complexes during cell cycle. These results suggest that the two distinct complexes are involved in different aspects of mitotic chromosome organization in humar cells.

Specifications

• Accession Number: O95347
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10592
• Name: Human SMC2 (aa 485-601) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730502P04Rik; AI255214; AW545314; CAP E; CAPE; CAP-E; Chromosome-associated protein E; FGF-inducible protein 16; fibroblast growth factor inducible 16; Fin16; FLJ10093; hCAP-E; PRO0324; SMC protein 2; Smc2; SMC-2; SMC2 (structural maintenance of chromosomes 2, yeast)-like 1; SMC2 protein; SMC2 structural maintenance of chromosomes 2-like 1; Smc2l1; structural maintenance of chromosomes (SMC) family member, chromosome-associated protein E; structural maintenance of chromosomes 2; structural maintenance of chromosomes protein 2; XCAP-E homolog
• Common Name: SMC2
• Gene Symbol: SMC2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSRDIGRLKETYEALLARFPNLRFAYKDPEKNWNRNCVKGLVASLISVKDTSATTALELVAGERLYNVVVDTEVTGKKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining