Invitrogen™ Human SMARCD2 (aa 70-131) Control Fragment Recombinant Protein

Product Code. 30199326

Brand: Invitrogen™ RP107055

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66380 (PA5-66380. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SMARCD2 is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein.The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein.

Specifications

• Accession Number: Q92925
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6603
• Name: Human SMARCD2 (aa 70-131) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 60 kDa BRG-1/Brm-associated factor subunit B; AW322457; Baf60b; BRG1-associated factor 60 B; chromatin remodeling complex BAF60B subunit; CRACD2; mammalian chromatin remodeling complex BRG1-associated factor 60 B; PRO2451; Rsc6p; SMARCD2; SWI/SNF complex 60 kDa subunit B; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2; Swp73-like protein
• Common Name: SMARCD2
• Gene Symbol: SMARCD2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QYQRPGMSPGNRMPMAGLQVGPPAGSPFGAAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining