missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SMARCD2 (aa 195-233) Control Fragment Recombinant Protein

Product Code. 30210154
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210154

Brand: Invitrogen™ RP106975

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66295 (PA5-66295. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SMARCD2 is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein.The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q92925
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6603
Name Human SMARCD2 (aa 195-233) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 60 kDa BRG-1/Brm-associated factor subunit B; AW322457; Baf60b; BRG1-associated factor 60 B; chromatin remodeling complex BAF60B subunit; CRACD2; mammalian chromatin remodeling complex BRG1-associated factor 60 B; PRO2451; Rsc6p; SMARCD2; SWI/SNF complex 60 kDa subunit B; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2; Swp73-like protein
Common Name SMARCD2
Gene Symbol SMARCD2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.