Invitrogen™ Human SMARCAD1 (aa 235-343) Control Fragment Recombinant Protein

Product Code. 30199858

Brand: Invitrogen™ RP91681

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53482 (PA5-53482. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SMARCAD1 belongs to the SNF2/RAD54 helicase family. It contains 2 CUE domains, 1 helicase ATP-binding domain, and 1 helicase C-terminal domain. It is a probable ATP-dependent DNA helicase.

Specifications

• Accession Number: Q9H4L7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56916
• Name: Human SMARCAD1 (aa 235-343) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ADERM; ATP-dependent helicase 1; ATP-dependent helicase SMARCAD1; AV081750; AW226546; D6Pas1; DKFZP762K2015; enhancer trap locus 1; enhancer trap locus homolog 1; Etl1; Etl-1; HEL1; hHEL1; KIAA1122; mKIAA1122; Smarcad1; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1; SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1
• Common Name: SMARCAD1
• Gene Symbol: SMARCAD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HGEESNESAESSSNWEKQESIVLKLQKEFPNFDKQELREVLKEHEWMYTEALESLKVFAEDQDMQYVSQSEVPNGKEVSSRSQNYPKNATKTKLKQKFSMKAQNGFNKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining