Invitrogen™ Human SMAD4 (aa 118-240) Control Fragment Recombinant Protein

Product Code. 30211719

Brand: Invitrogen™ RP102284

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Smad4 is encoded by the Smad4 gene that is located on chromosome 18 in humans. Smad4 is also known as Smad family member 4, Sma- and Mad-related protein 4 or Mothers against decapentaplegic (MAD) homolog 4. Smad4 contains N-terminal MH1 (MAD homology 1) and C-terminal MH2 (MAD homology 2) globular domains that are involved in DNA binding and protein interactions respectively. Binding of the TGF-beta superfamily of ligands that includes Transforming Growth Factor -beta (TGF-beta) and bone morphogenetic protein (BMP) to its cognate receptor allows phosphorylation of Smad 1, 2, 3, 5 and 8 (R-Smad, Receptor Smad). This signals for heterotrimerization with Smad4 (co-Smad, co-mediator Smad) and translocation of the complex to the nucleus. Inhibitory or antagonistic Smad (I-Smad) that includes Smad 6 and 7, interact with activated R-Smads and attenuate the signaling pathway. Smad4 acts as a tumor suppressor protein by transcriptionally regulating its target genes such as Cyclin D1 (downregulation) and collagen (upregulation) that inhibit cell proliferation. Dephosphorylation regulates nuclear export and nucleocytoplasmic dynamics of Smads.

Specifications

• Accession Number: Q13485
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4089
• Name: Human SMAD4 (aa 118-240) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW743858; D18Wsu70e; Deleted in Pancreatic Carcinoma 4 (DPC4); deleted in pancreatic carcinoma locus 4; deletion target in pancreatic carcinoma 4; Deletion target in pancreatic carcinoma 4 homolog; DPC4; hSMAD4; JIP; MAD (mothers against decapentaplegic Drosophila) homolog 4; MAD homolog 4; MAD homolog 4 (MADH4); Madh4; mothers against decapentaplegic homolog 4; Mothers against decapentaplegic homolog 4 (MADH4); mothers against decapentaplegic, Drosophila, homolog of, 4; mothers against DPP homolog 4; MYHRS; SMAD; SMAD 4; SMAD family member 4; SMAD, mothers against DPP homolog 4; SMAD4
• Common Name: SMAD4
• Gene Symbol: SMAD4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining