Invitrogen™ Human SLCO5A1 (aa 385-432) Control Fragment Recombinant Protein

Product Code. 30207231

Brand: Invitrogen™ RP93798

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55218 (PA5-55218. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a 12 transmembrane domain protein that is a member of the solute carrier organic anion transporter superfamily. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q9H2Y9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 81796
• Name: Human SLCO5A1 (aa 385-432) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4732454B15; A630033C23Rik; AA407151; LOW QUALITY PROTEIN: solute carrier organic anion transporter family member 5A1; OATP5A1; OATPJ; OATP-J; OATPRP4; OATP-RP4; organic anion transporter polypeptide-related protein 4; SLC21A15; SLCO5A1; solute carrier family 21 (organic anion transporter), member 15; solute carrier family 21 member 15; Solute carrier organic anion transporter family member 5A1; solute carrier organic anion transporter family, member 5A1
• Common Name: SLCO5A1
• Gene Symbol: SLCO5A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SVDAVSDDDVLKEKSNNSEQADKKVSSMGFGKDVRDLPRAAVRILSNM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining