missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201391

Invitrogen™ Human SLCO3A1 (aa 125-175) Control Fragment Recombinant Protein

Product Code. 30201391
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201391

Brand: Invitrogen™ RP108514

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84720 (PA5-84720. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLCO3A1 mediates the Na+-independent transport of organic anions such as estrone-3-sulfate. It mediates transport of prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123 and vasopressin, but not DPDPE (a derivative of enkephalin lacking an N-terminal tyrosine residue), estrone-3-sulfate, taurocholate, digoxin nor DHEAS.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UIG8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 28232
Name Human SLCO3A1 (aa 125-175) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5830414C08Rik; androgen regulated protein 1; Anr1; FLJ40478; LOW QUALITY PROTEIN: solute carrier organic anion transporter family member 3A1; MJAM; OATP3A1; OATPD; OATP-D; OATPRP3; OATP-RP3; Organic anion transporter polypeptide-related protein 3; organic anion transporting polypeptide 3a1; organic anion-transporting polypeptide D; PGE1 transporter; Pgt2; Prostaglandin transporter subtype 2; R75096; si:ch211-196l7.1; SLC21A11; Slco3a1; Sodium-independent organic anion transporter D; solute carrier family 21 (organic anion transporter), member 11; solute carrier family 21 member 11; Solute carrier organic anion transporter family member 3A1; solute carrier organic anion transporter family, member 3A1; wu:fa93e11; zOatp3a2
Common Name SLCO3A1
Gene Symbol SLCO3A1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LPEFLTHQYKYEAGEIRWGAEGRDVCAANGSGGDEGPDPDLICRNRTATNM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.