Invitrogen™ Human SLC7A4 (aa 586-635) Control Fragment Recombinant Protein

Product Code. 30194573

Brand: Invitrogen™ RP95378

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56619 (PA5-56619. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in the transport of the cationic amino acids (arginine, lysine and ornithine).

Specifications

• Accession Number: O43246
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6545
• Name: Human SLC7A4 (aa 586-635) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CAT4; CAT-4; Cationic amino acid transporter 4; HCAT3; Ig heavy chain variable region; SLC7A4; solute carrier family 7 (cationic amino acid transporter, y+ system), member 4; solute carrier family 7 (orphan transporter), member 4; solute carrier family 7 member 4; solute carrier family 7, member 4; VH; VH 3 family
• Common Name: SLC7A4
• Gene Symbol: SLC7A4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GIRHSKENQRELPGLNSTHYVVFPRGSLEETVQAMQPPSQAPAQDPGHME
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining