missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30181177

Invitrogen™ Human SLC7A1 (aa 436-496) Control Fragment Recombinant Protein

Product Code. 30181177
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181177

Brand: Invitrogen™ RP97969

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC7A1 is a high-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. It may also function as an ecotropic retroviral leukemia receptor.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P30825
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6541
Name Human SLC7A1 (aa 436-496) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4831426K01Rik; AI447493; amino acid transporter, cationic 1; ATRC1; Atrc-1; Cat1; CAT-1; cationic amino acid transporter 1; cationic amino acid transporter, y+ system; cationic amino acid transporter-1; cationic amion acid transporter; y+ system; cationinc amino acid transporter 1; ecotropic retroviral leukemia receptor; Ecotropic retroviral leukemia receptor homolog; ecotropic retroviral receptor; ecotropic retrovirus receptor; Ecotropic retrovirus receptor homolog; ERR; HCAT1; high affinity cationic amino acid transporter 1; mCAT-1; Rec-1; REC1L; Rev-1; Slc7a1; solute carrier family 7 (cationic amino acid transporter, y+ system), member 1; solute carrier family 7 member 1; Solute carrier family 7 member A1 (amino acid transporter cationic 1); solute carrier family 7, member 1; system Y+ basic amino acid transporter
Common Name SLC7A1
Gene Symbol SLC7A1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.