Invitrogen™ Human SLC6A7 (aa 147-211) Control Fragment Recombinant Protein

Product Code. 30194878

Brand: Invitrogen™ RP102357

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56009 (PA5-56009. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the gamma-aminobutyric acid (GABA) neurotransmitter gene family and encodes a high-affinity mammalian brain L-proline transporter protein. This transporter protein differs from other sodium-dependent plasma membrane carriers by its pharmacological specificity, kinetic properties, and ionic requirements.

Specifications

• Accession Number: Q99884
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6534
• Name: Human SLC6A7 (aa 147-211) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW455934; brain-specific L-proline transporter; L-proline transporter; proline transporter; Prot; Slc6a7; sodium-dependent proline transporter; solute carrier family 6 (neurotransmitter transporter), member 7; solute carrier family 6 (neurotransmitter transporter, L-proline), member 7; solute carrier family 6 member 7
• Common Name: SLC6A7
• Gene Symbol: SLC6A7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLTSDLPWEHCGNWWNTELCLEHRVSKDGNGALPLNLTCTVSPSEEYWSRYVLHIQGSQGIGSPG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining