missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SLC6A15 (aa 10-69) Control Fragment Recombinant Protein

Product Code. 30210829
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30210829 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30210829 Supplier Invitrogen™ Supplier No. RP89570

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52586 (PA5-52586. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC6A15 (solute carrier family 6 (neutral amino acid transporter), member 15), also known as sodium-dependent neutral amino acid transporter B(0)AT2, transporter v7-3, NTT73 or sodium-coupled branched-chain amino-acid transporter 1 (SBAT1), is a 730 amino acid multi-pass membrane protein that acts as a sodium-dependent neutral amino acid transporter. A member of the sodium neurotransmitter symporter (SNF) family and SLC6A15 subfamily, SLC6A15 differs from other members of its family in that it does not appear to be chloride-dependent. SLC6A15 is expressed in brain and is encoded by a gene that maps to human chromosome 12, which encodes over 1,100 genes and comprises approximately 4. 5% of the human genome. Chromosome 12 is associated with a variety of diseases and afflictions, including hypochondrogenesis, achondrogenesis, Kniest dysplasia, Noonan syndrome and trisomy 12p, which causes facial developmental defects and seizure disorders.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H2J7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55117
Name Human SLC6A15 (aa 10-69) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA536730; AI326450; AI326451; B0at2; B0AT2 protein; homolog of rat orphan transporter v7-3; hv7-3; NTT73; orphan sodium- and chloride-dependent neurotransmitter transporter NTT73; orphan transporter v7-3; SBAT1; SLC6A15; sodium- and chloride-dependent neurotransmitter transporter NTT73; sodium/chloride dependent neurotransmitter transporter Homo sapiens orphan neurotransmitter transporter NTT7; sodium-coupled branched-chain amino-acid transporter 1; Sodium-dependent neutral amino acid transporter B(0)AT2; solute carrier family 6 (neurotransmitter transporter), member 15; solute carrier family 6 (neutral amino acid transporter), member 15; solute carrier family 6 member 15; solute carrier family 6, member 15; transporter v7-3; V7-3
Common Name SLC6A15
Gene Symbol Slc6a15
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDERPAWNSKLQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.