Invitrogen™ Human SLC6A15 (aa 10-69) Control Fragment Recombinant Protein

Product Code. 30210829

Brand: Invitrogen™ RP89570

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52586 (PA5-52586. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC6A15 (solute carrier family 6 (neutral amino acid transporter), member 15), also known as sodium-dependent neutral amino acid transporter B(0)AT2, transporter v7-3, NTT73 or sodium-coupled branched-chain amino-acid transporter 1 (SBAT1), is a 730 amino acid multi-pass membrane protein that acts as a sodium-dependent neutral amino acid transporter. A member of the sodium neurotransmitter symporter (SNF) family and SLC6A15 subfamily, SLC6A15 differs from other members of its family in that it does not appear to be chloride-dependent. SLC6A15 is expressed in brain and is encoded by a gene that maps to human chromosome 12, which encodes over 1,100 genes and comprises approximately 4. 5% of the human genome. Chromosome 12 is associated with a variety of diseases and afflictions, including hypochondrogenesis, achondrogenesis, Kniest dysplasia, Noonan syndrome and trisomy 12p, which causes facial developmental defects and seizure disorders.

Specifications

• Accession Number: Q9H2J7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55117
• Name: Human SLC6A15 (aa 10-69) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA536730; AI326450; AI326451; B0at2; B0AT2 protein; homolog of rat orphan transporter v7-3; hv7-3; NTT73; orphan sodium- and chloride-dependent neurotransmitter transporter NTT73; orphan transporter v7-3; SBAT1; SLC6A15; sodium- and chloride-dependent neurotransmitter transporter NTT73; sodium/chloride dependent neurotransmitter transporter Homo sapiens orphan neurotransmitter transporter NTT7; sodium-coupled branched-chain amino-acid transporter 1; Sodium-dependent neutral amino acid transporter B(0)AT2; solute carrier family 6 (neurotransmitter transporter), member 15; solute carrier family 6 (neutral amino acid transporter), member 15; solute carrier family 6 member 15; solute carrier family 6, member 15; transporter v7-3; V7-3
• Common Name: SLC6A15
• Gene Symbol: Slc6a15
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDERPAWNSKLQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining