Invitrogen™ Human SLC6A14 (aa 147-233) Control Fragment Recombinant Protein

Product Code. 30196826

Brand: Invitrogen™ RP92172

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the solute carrier family 6. Members of this family are sodium and chloride dependent neurotransmitter transporters. The encoded protein transports both neutral and cationic amino acids.

Specifications

• Accession Number: Q9UN76
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11254
• Name: Human SLC6A14 (aa 147-233) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110007A17Rik; 9030613J17Rik; amino acid transporter ATB0+; amino acid transporter B0; amino acid transporter B0+; ATB(0+); Atb0+; ATB0plus; BMIQ11; carrier protein; CATB0plus; colonic system B0+ amino acid transporter; colonic system B0+ amino acid transporter CATB0+; LOW QUALITY PROTEIN: sodium- and chloride-dependent neutral and basic amino acid transporter B(0+); neutral cationic amino acid transporter B0,+; SLC6A14; Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+); solute carrier family 6 (amino acid transporter), member 14; solute carrier family 6 (neurotransmitter transporter), member 14; solute carrier family 6 member 14
• Common Name: SLC6A14
• Gene Symbol: SLC6A14
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining