missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SLC6A11 (aa 578-632) Control Fragment Recombinant Protein

Product Code. 30199376
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199376

Brand: Invitrogen™ RP96336

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58192 (PA5-58192. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Slc6a11 encode GABA transporters that are sodium- and chloride-dependent members of the solute carrier family 6 (SLC6) and mediate the rapid removal of GABA and maintain low extracellular levels. Four 12-TM domain transporters have been identified and localized to neurons and glia. The protein encoded by the Slc6a11 gene is a sodium-dependent transporter that uptakes gamma-aminobutyric acid (GABA), an inhibitory neurotransmitter, which ends the GABA neurotransmission. Defects in the Slc6a11 gene may result in epilepsy, behavioral problems, or intellectual problems. Two transcript variants encoding different isoforms have been found for the Slc6a11 gene. Diseases associated with SLC6A11 include Tricuspid Valve Stenosis and Pulmonary Valve Insufficiency.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P48066
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6538
Name Human SLC6A11 (aa 578-632) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias D930045G19Rik; E130202I16Rik; GABA transporter 3; GABA transporter GAT-3; GABT3; Gabt4; gamma-aminobutyric acid (GABA-A) transporter 4; Gat3; GAT-3; Gat4; GAT-4; Gat-b; SLC6A11; Sodium- and chloride-dependent GABA transporter 3; sodium- and chloride-dependent GABA transporter 4; solute carrier family 6 (neurotransmitter transporter), member 11; solute carrier family 6 (neurotransmitter transporter, GABA), member 11; solute carrier family 6 member 11
Common Name SLC6A11
Gene Symbol SLC6A11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GTLPEKLQKLTTPSTDLKMRGKLGVSPRMVTVNDCDAKLKSDGTIAAITEKETHF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.