Invitrogen™ Human SLC6A11 (aa 578-632) Control Fragment Recombinant Protein

Product Code. 30199376

Brand: Invitrogen™ RP96336

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58192 (PA5-58192. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Slc6a11 encode GABA transporters that are sodium- and chloride-dependent members of the solute carrier family 6 (SLC6) and mediate the rapid removal of GABA and maintain low extracellular levels. Four 12-TM domain transporters have been identified and localized to neurons and glia. The protein encoded by the Slc6a11 gene is a sodium-dependent transporter that uptakes gamma-aminobutyric acid (GABA), an inhibitory neurotransmitter, which ends the GABA neurotransmission. Defects in the Slc6a11 gene may result in epilepsy, behavioral problems, or intellectual problems. Two transcript variants encoding different isoforms have been found for the Slc6a11 gene. Diseases associated with SLC6A11 include Tricuspid Valve Stenosis and Pulmonary Valve Insufficiency.

Specifications

• Accession Number: P48066
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6538
• Name: Human SLC6A11 (aa 578-632) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: D930045G19Rik; E130202I16Rik; GABA transporter 3; GABA transporter GAT-3; GABT3; Gabt4; gamma-aminobutyric acid (GABA-A) transporter 4; Gat3; GAT-3; Gat4; GAT-4; Gat-b; SLC6A11; Sodium- and chloride-dependent GABA transporter 3; sodium- and chloride-dependent GABA transporter 4; solute carrier family 6 (neurotransmitter transporter), member 11; solute carrier family 6 (neurotransmitter transporter, GABA), member 11; solute carrier family 6 member 11
• Common Name: SLC6A11
• Gene Symbol: SLC6A11
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GTLPEKLQKLTTPSTDLKMRGKLGVSPRMVTVNDCDAKLKSDGTIAAITEKETHF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining